Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Min Veggie Naan Pizza

Crispy naan topped with pizza sauce, melted mozzarella, and caramelized bell pepper — ready in 5 minutes. The fastest weeknight dinner that still feels like pizza.

Total time
5 min
Servings
2
Calories
385
Protein
14g
5-Min Veggie Naan Pizza
quickcasualitalianvegetariancrispymeltyweeknightpizza

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice bell pepper into thin rings, removing the seeds.

  2. Step 2

    Spread 2 tablespoons pizza sauce on each naan, leaving a 1/2-inch border.

  3. Step 3

    Top with pepper rings, then sprinkle mozzarella evenly over each naan.

  4. Step 4

    Broil 4 inches from heat until cheese bubbles and edges char, 2–3 minutes.

  5. Step 5

    Serve immediately while cheese is melted and edges are still warm.

Tools you’ll need

  • cutting board
  • sharp knife
  • baking sheet
  • broiler

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.