CookSnap is in beta — Get it free on TestFlight →
Back to recipes

5-Min Veggie Naan Pizza

Crispy naan topped with pizza sauce, melted mozzarella, and caramelized bell pepper — ready in 5 minutes. The fastest weeknight dinner that still feels like pizza.

Total time
5 min
Servings
2
Calories
385
Protein
14g
5-Min Veggie Naan Pizza
quickcasualitalianvegetariancrispymeltyweeknightpizza

Ingredients

  • 2 pieces naan
  • ½ cup pizza sauce
  • 1 large bell pepper
  • 1 cup mozzarella cheese, shredded

Instructions

  1. 1

    Slice bell pepper into thin rings, removing the seeds.

  2. 2

    Spread 2 tablespoons pizza sauce on each naan, leaving a 1/2-inch border.

  3. 3

    Top with pepper rings, then sprinkle mozzarella evenly over each naan.

  4. 4

    Broil 4 inches from heat until cheese bubbles and edges char, 2–3 minutes.

  5. 5

    Serve immediately while cheese is melted and edges are still warm.

Tools you’ll need

  • cutting board
  • sharp knife
  • baking sheet
  • broiler

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.