Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pork Ribs with Mustard Glaze

Sheet-pan pork ribs roasted until edges crisp, then glazed with tangy Dijon mustard, brown sugar, and caraway. Ready in under 25 minutes—a Scandinavian-inspired weeknight dinner that feels special.

Total time
25 min
Servings
4
Calories
385
Protein
32g
Crispy Pork Ribs with Mustard Glaze
satisfyingrusticscandinavianporkcrispytenderweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Pat ribs dry with paper towels, then season generously with salt and pepper.

  2. Step 2

    Spread ribs on a sheet pan in a single layer, bone-side down. Roast for 12 minutes until edges brown.

  3. Step 3

    While ribs roast, whisk together Dijon, brown sugar, caraway, vinegar, and paprika in a small bowl.

  4. Step 4

    Remove pan from oven. Brush glaze generously over the top of each rib piece.

  5. Step 5

    Return to oven and roast for 8 more minutes until glaze is sticky and edges look caramelized.

  6. Step 6

    Let cool 2 minutes. Serve hot with extra glaze drizzled on the side.

Tools you’ll need

  • sheet pan
  • paper towels
  • small mixing bowl
  • whisk
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.