Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Potato Farl With Butter & Scallions

Pan-fried Irish potato farls: mashed potatoes mixed into a quick dough, cut into wedges, and crisped until golden. Serve hot with melting butter and sharp cheddar for a complete weeknight meal.

Total time
25 min
Servings
2
Calories
385
Protein
9g
Crispy Potato Farl With Butter & Scallions
comfortcozyirishvegetarianvegetariancrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Chop potatoes into 1-inch cubes, boil in salted water until fork-tender, about 12 minutes. Drain well.

  2. Step 2

    Mash potatoes until smooth. Stir in flour, 2 tbsp butter, cheese, and scallions. Season with salt and pepper.

  3. Step 3

    Divide dough in half. Pat each half into a 6-inch disk on parchment, then cut each into 4 wedges.

  4. Step 4

    Heat 1 tbsp butter in a large skillet over medium-high until foaming. Fry farls in two batches, 3–4 minutes per side until golden and crispy.

  5. Step 5

    Transfer to a plate, top with remaining 1 tbsp butter. Serve hot with extra cheese or sour cream if desired.

Tools you’ll need

  • chef's knife
  • cutting board
  • pot (3-quart)
  • colander
  • mixing bowl
  • wooden spoon
  • parchment paper
  • 12-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.