Custrd is out on the App Store — Download it free →
Back to recipes

Crispy Potato Pancakes with Cottage Cheese

Shredded potato pancakes, golden and crispy on the outside, with a fluffy center. Serve with cold cottage cheese for a satisfying weeknight dinner that comes together in 20 minutes.

Total time
20 min
Servings
2
Calories
285
Protein
9g
Crispy Potato Pancakes with Cottage Cheese
comfortsimpleamericanvegetarianeggscrispyfluffyweeknight

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Shred the potato and onion on a box grater, then squeeze out excess liquid with paper towels.

  2. Step 2

    Mix shredded potato and onion with egg, flour, salt, and pepper until combined.

  3. Step 3

    Heat oil in a large skillet over medium-high until shimmering, about 1 minute.

  4. Step 4

    Drop spoonfuls of potato mixture into the skillet, flatten with a spatula, and cook 3–4 minutes per side until golden brown.

  5. Step 5

    Transfer pancakes to a plate and serve hot with cottage cheese on the side.

Tools you’ll need

  • box grater
  • large skillet (10–12 inches)
  • spatula
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.