Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Pretzel Sticks with Whole-Grain Mustard

German laugenstange reimagined as a fast, chewy pretzel-style breadstick you can make in one bowl and bake on a sheet pan. Boiled in baking soda, brushed with butter, and finished with coarse salt—ready in 18 minutes.

Total time
18 min
Servings
4
Calories
208
Protein
6g
Crispy Pretzel Sticks with Whole-Grain Mustard
casualsimplegermanvegetarianchewycrispyweeknightsnack

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix 2 cups flour, 0.75 cup warm water, 1.5 tsp yeast, and 1 tsp salt in a bowl until shaggy.

  2. Step 2

    Knead by hand 3 minutes until smooth, then divide into 8 equal pieces and roll each into a 10-inch rope.

  3. Step 3

    Bring a pot of water to a boil, stir in 2 tbsp baking soda, then dunk each rope 20 seconds per side.

  4. Step 4

    Place boiled sticks on a sheet pan lined with parchment, brush with melted butter, sprinkle with coarse salt.

  5. Step 5

    Bake at 425°F for 8–10 minutes until deep golden and crispy on edges.

  6. Step 6

    Cool 2 minutes, then serve warm with mustard or as-is.

Tools you’ll need

  • large mixing bowl
  • rolling surface
  • large pot
  • sheet pan
  • parchment paper
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.