Back to recipes
Crispy Ranch Baked Wings
Chicken wings coated in ranch seasoning and olive oil, baked until golden and crispy. Serve with ranch dipping sauce for the ultimate weeknight comfort meal.
- Total time
- 25 min
- Servings
- 4
- Calories
- 420
- Protein
- 38g
comfortcasualamericanchickencrispytenderweeknightgame-day
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Pat chicken wings dry with paper towels, then toss with olive oil and ranch seasoning until fully coated.
Step 2
Spread wings in a single layer on a sheet pan lined with foil.
Step 3
Bake at 425°F for 20 minutes, shaking the pan halfway through, until edges are golden and crispy.
Step 4
Serve hot with ranch dipping sauce on the side.
Tools you’ll need
- sheet pan
- aluminum foil
- paper towels
- large bowl
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
