Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Sambusa with Chili Sauce

Golden fried pastry triangles stuffed with spiced ground meat, served with fiery chili sauce and fresh cilantro. A weeknight-friendly take on the Ethiopian classic — no phyllo folding required.

Total time
28 min
Servings
2
Calories
420
Protein
18g
Crispy Sambusa with Chili Sauce
comfortcasualethiopianbeefcrispytenderweeknightdinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Brown ground beef in a skillet over medium-high, breaking it apart with a spoon until no pink remains, about 5 minutes.

  2. Step 2

    Add diced onion and ginger-garlic paste, cooking for 1 minute until fragrant, then stir in chili powder and tomato paste.

  3. Step 3

    Cook the filling for 2 minutes, then remove from heat and stir in half the cilantro. Season with salt and pepper.

  4. Step 4

    Spoon 1 tbsp filling into the center of each wonton wrapper, fold into a triangle, and press edges to seal.

  5. Step 5

    Heat oil in a heavy pot to 350°F (use a thermometer). Fry sambusat 2–3 per batch until golden brown, about 90 seconds per side.

  6. Step 6

    Drain on paper towels and serve hot with chili sauce, remaining cilantro, and fresh sliced red chilies on the side.

Tools you’ll need

  • 12-inch skillet
  • heavy-bottomed pot
  • deep-fry or candy thermometer
  • wooden spoon
  • paper towels
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.