CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Sambusa with Spiced Beef & Lettuce

Golden, triangular pastries stuffed with seasoned ground beef and potatoes, fried until crispy and served on fresh lettuce. A TikTok-friendly take on Ethiopian sambusa that comes together in under 30 minutes.

Total time
28 min
Servings
4
Calories
320
Protein
14g
Crispy Sambusa with Spiced Beef & Lettuce
casualsatisfyingethiopianbeefcrispytenderweeknightdinner

Ingredients

  • ½ lb ground beef
  • 1 medium potato, diced small
  • ¼ cup yellow onion, minced
  • 1 tbsp ginger-garlic paste
  • 1.5 tsp Ethiopian spice blend (berbere or curry powder)
  • 12 count wonton wrappers or phyllo sheets
  • 2 cups fresh lettuce, torn

Instructions

  1. 1

    Boil diced potato in salted water until just tender, about 5 minutes. Drain and set aside.

  2. 2

    Heat oil in a skillet over medium-high. Brown ground beef, breaking it up with a spoon, until no pink remains, ~6 minutes.

  3. 3

    Add minced onion and ginger-garlic paste. Stir until fragrant, about 90 seconds.

  4. 4

    Stir in cooked potato and berbere spice. Cook for 1 minute, then remove from heat and cool slightly.

  5. 5

    Place 1 tbsp filling on the corner of each wonton wrapper. Fold into a triangle, seal edges with water.

  6. 6

    Heat oil to 350°F in a deep skillet. Fry sambusos 2–3 minutes per side until deep golden. Drain on paper towels.

  7. 7

    Serve sambusos on a bed of fresh lettuce.

Tools you’ll need

  • medium pot
  • large skillet
  • spoon
  • deep skillet or heavy-bottomed pot
  • cooking thermometer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.