Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Sambusa with Spiced Beef & Lettuce

Golden, triangular pastries stuffed with seasoned ground beef and potatoes, fried until crispy and served on fresh lettuce. A TikTok-friendly take on Ethiopian sambusa that comes together in under 30 minutes.

Total time
28 min
Servings
4
Calories
320
Protein
14g
Crispy Sambusa with Spiced Beef & Lettuce
casualsatisfyingethiopianbeefcrispytenderweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil diced potato in salted water until just tender, about 5 minutes. Drain and set aside.

  2. Step 2

    Heat oil in a skillet over medium-high. Brown ground beef, breaking it up with a spoon, until no pink remains, ~6 minutes.

  3. Step 3

    Add minced onion and ginger-garlic paste. Stir until fragrant, about 90 seconds.

  4. Step 4

    Stir in cooked potato and berbere spice. Cook for 1 minute, then remove from heat and cool slightly.

  5. Step 5

    Place 1 tbsp filling on the corner of each wonton wrapper. Fold into a triangle, seal edges with water.

  6. Step 6

    Heat oil to 350°F in a deep skillet. Fry sambusos 2–3 minutes per side until deep golden. Drain on paper towels.

  7. Step 7

    Serve sambusos on a bed of fresh lettuce.

Tools you’ll need

  • medium pot
  • large skillet
  • spoon
  • deep skillet or heavy-bottomed pot
  • cooking thermometer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.