Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Sara Udon with Shrimp

Tangled crispy fried noodles topped with tender shrimp in a light, savory Japanese sauce. Crunchy, fresh, and restaurant-ready in under 20 minutes.

Total time
20 min
Servings
2
Calories
485
Protein
22g
Crispy Sara Udon with Shrimp
lightfreshjapaneseshrimpcrispytenderchewyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil ramen noodles in salted water for 3 minutes. Drain and set aside.

  2. Step 2

    Stir together soy sauce and mirin in a small bowl.

  3. Step 3

    Heat 1.5 tbsp oil in a large skillet over medium-high until shimmering.

  4. Step 4

    Add noodles in a loose nest. Fry 4–5 minutes without stirring until bottom is golden and crispy.

  5. Step 5

    Flip noodles and fry the other side 3–4 minutes until crispy all over. Transfer to a plate.

  6. Step 6

    Add remaining 1.5 tbsp oil to the skillet. Sauté shrimp until pink, 3–4 minutes.

  7. Step 7

    Pour soy-mirin sauce into the skillet and toss shrimp to coat, 30 seconds.

  8. Step 8

    Place crispy noodles on plates. Top with shrimp and sauce. Garnish with green onion and sesame seeds.

Tools you’ll need

  • large pot for boiling
  • 12-inch skillet
  • small bowl for sauce
  • spatula or tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.