CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Shrimp Tempura Soba

Tender soba noodles in a savory dashi broth, topped with golden crispy shrimp tempura. A restaurant-quality Japanese dinner ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
26g
Crispy Shrimp Tempura Soba
satisfyingelegantjapaneseshrimpcrispytenderchewyweeknight

Ingredients

  • 7 oz soba noodles
  • 10 oz shrimp, peeled and patted dry
  • 2 cups dashi broth (or instant dashi + water)
  • 3 tbsp soy sauce
  • 2 tbsp mirin
  • ½ cup all-purpose flour
  • 2 tbsp scallions and nori (seaweed), sliced or shredded

Instructions

  1. 1

    Bring dashi broth to a simmer in a large pot. Whisk in soy sauce and mirin. Keep hot over low heat.

  2. 2

    Boil soba noodles in salted water until al dente, about 4 minutes. Drain and set aside.

  3. 3

    Toss shrimp with flour and a pinch of salt. Heat neutral oil in a skillet over medium-high until it shimmers.

  4. 4

    Pan-fry shrimp in batches until golden and crispy, about 2 minutes per side. Transfer to a plate.

  5. 5

    Divide cooked soba between two bowls. Pour hot broth over the noodles, dividing evenly.

  6. 6

    Top each bowl with crispy shrimp, scallions, and nori. Serve immediately.

Tools you’ll need

  • large pot
  • medium skillet
  • whisk
  • tongs
  • two bowls
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.