Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Shrimp Tempura Soba

Tender soba noodles in a savory dashi broth, topped with golden crispy shrimp tempura. A restaurant-quality Japanese dinner ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
26g
Crispy Shrimp Tempura Soba
satisfyingelegantjapaneseshrimpcrispytenderchewyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring dashi broth to a simmer in a large pot. Whisk in soy sauce and mirin. Keep hot over low heat.

  2. Step 2

    Boil soba noodles in salted water until al dente, about 4 minutes. Drain and set aside.

  3. Step 3

    Toss shrimp with flour and a pinch of salt. Heat neutral oil in a skillet over medium-high until it shimmers.

  4. Step 4

    Pan-fry shrimp in batches until golden and crispy, about 2 minutes per side. Transfer to a plate.

  5. Step 5

    Divide cooked soba between two bowls. Pour hot broth over the noodles, dividing evenly.

  6. Step 6

    Top each bowl with crispy shrimp, scallions, and nori. Serve immediately.

Tools you’ll need

  • large pot
  • medium skillet
  • whisk
  • tongs
  • two bowls
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.