Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Shao Bing & Youtiao

Flaky puff pastry folded with scallions and sesame, topped with a gooey egg and crispy fried dough sticks. A Taiwanese breakfast-for-dinner that tastes like a street stall in your skillet.

Total time
20 min
Servings
2
Calories
520
Protein
12g
Crispy Shao Bing & Youtiao
casualsatisfyingtaiwaneseeggscrispyflakytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Unfold puff pastry on a cutting board and brush lightly with water. Sprinkle scallions, sesame seeds, and half the fried shallots across the surface.

  2. Step 2

    Roll pastry tightly into a log, then curl it into a spiral. Flatten gently with your palm until about 1/2-inch thick.

  3. Step 3

    Heat 2 tbsp oil in a 12-inch skillet over medium-high until shimmering. Slide the spiral into the pan and sear 3–4 minutes per side until golden brown and crispy.

  4. Step 4

    Push pastry to the side of the skillet. Crack eggs into the empty space and cook until whites set but yolks still jiggle, about 2 minutes.

  5. Step 5

    Lay halved youtiao pieces on top of the pastry. Drizzle soy sauce over everything and scatter remaining fried shallots.

  6. Step 6

    Serve hot straight from the skillet. Tear pieces and dip in extra soy sauce if desired.

Tools you’ll need

  • cutting board
  • 12-inch skillet
  • silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.