Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Shrimp Crepe with Nuoc Cham

Golden, crispy crepe stuffed with sizzling shrimp, served with tangy nuoc cham, fresh herbs, and chili paste. Grabs from Vietnamese street food in under 15 minutes.

Total time
15 min
Servings
2
Calories
280
Protein
18g
15-Min Crispy Shrimp Crepe with Nuoc Cham
casualfreshvietnameseshrimpcrispytenderweeknightcasual

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix fish sauce and lime juice in a small bowl for nuoc cham sauce.

  2. Step 2

    Heat 1 tbsp oil in a 10-inch nonstick skillet over medium-high heat until shimmering.

  3. Step 3

    Add shrimp and cook without moving for 90 seconds until edges curl, then flip and cook 60 seconds more.

  4. Step 4

    Slide shrimp onto a plate. Add remaining oil to skillet, then lay one crepe flat and warm 30 seconds per side until pliable.

  5. Step 5

    Fill crepe with herbs, lettuce, and cooked shrimp; fold or roll loosely. Repeat with second crepe.

  6. Step 6

    Serve with nuoc cham and chili paste on the side for dipping.

Tools you’ll need

  • 10-inch nonstick skillet
  • small mixing bowl
  • tongs
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.