CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Shrimp Dynamite Roll

Tempura shrimp + spicy mayo wrapped in crispy rice and nori, ready in under 25 minutes. A TikTok-friendly take on the sushi bar classic—no sushi-rolling experience needed.

Total time
25 min
Servings
2
Calories
520
Protein
18g
Crispy Shrimp Dynamite Roll
indulgentcelebratoryjapaneseshrimpcrispytenderchewyweeknight

Ingredients

  • 12 count large shrimp, peeled and deveined
  • ¾ cup all-purpose flour
  • ¾ cup cornstarch
  • 3 tbsp sriracha or gochujang
  • ½ cup mayonnaise
  • 4 count nori sheets
  • 2 cups cooked sushi rice, cooled

Instructions

  1. 1

    Stir sriracha into mayo until smooth and bright red.

  2. 2

    Mix flour and cornstarch in a shallow bowl. Whisk together 0.75 cup cold water + 1 egg yolk until foamy.

  3. 3

    Heat 2 inches of neutral oil in a heavy pot to 350°F (use a thermometer—don't skip this).

  4. 4

    Dip each shrimp into the foamy batter, then into the flour mixture. Fry in batches without crowding until golden and crispy, 2–3 minutes.

  5. 5

    Lay a nori sheet shiny-side down. Spread 0.5 cup rice evenly, pressing gently. Flip so rice is on the outside.

  6. 6

    Arrange 3 shrimp and a stripe of spicy mayo across the nori. Roll tightly using the mat, then slice into 6 pieces with a wet knife.

Tools you’ll need

  • heavy-bottomed pot or wok
  • instant-read thermometer
  • shallow bowl
  • whisk
  • bamboo sushi mat
  • sharp serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.