Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Shrimp Dynamite Roll

Tempura shrimp + spicy mayo wrapped in crispy rice and nori, ready in under 25 minutes. A TikTok-friendly take on the sushi bar classic—no sushi-rolling experience needed.

Total time
25 min
Servings
2
Calories
520
Protein
18g
Crispy Shrimp Dynamite Roll
indulgentcelebratoryjapaneseshrimpcrispytenderchewyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Stir sriracha into mayo until smooth and bright red.

  2. Step 2

    Mix flour and cornstarch in a shallow bowl. Whisk together 0.75 cup cold water + 1 egg yolk until foamy.

  3. Step 3

    Heat 2 inches of neutral oil in a heavy pot to 350°F (use a thermometer—don't skip this).

  4. Step 4

    Dip each shrimp into the foamy batter, then into the flour mixture. Fry in batches without crowding until golden and crispy, 2–3 minutes.

  5. Step 5

    Lay a nori sheet shiny-side down. Spread 0.5 cup rice evenly, pressing gently. Flip so rice is on the outside.

  6. Step 6

    Arrange 3 shrimp and a stripe of spicy mayo across the nori. Roll tightly using the mat, then slice into 6 pieces with a wet knife.

Tools you’ll need

  • heavy-bottomed pot or wok
  • instant-read thermometer
  • shallow bowl
  • whisk
  • bamboo sushi mat
  • sharp serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.