Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Spicy Shrimp Tempura Roll

Crispy shrimp tempura wrapped in sushi rice and nori, topped with spicy mayo and sriracha for a knockout TikTok-viral Japanese-American hybrid. Ready in under 25 minutes with zero fuss.

Total time
25 min
Servings
2
Calories
620
Protein
18g
Spicy Shrimp Tempura Roll
indulgentcasualjapaneseshrimpcrispytenderweeknightdate-night

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour, cornstarch, cold water, and a pinch of salt until lumpy. Pat shrimp dry.

  2. Step 2

    Heat oil in a deep skillet to 350°F. Dip shrimp in batter and fry until golden, 2 minutes.

  3. Step 3

    Drain fried shrimp on paper towels. Mix mayo and sriracha in a small bowl.

  4. Step 4

    Lay nori shiny-side down. Spread sushi rice in a thin layer, leaving a 0.5-inch border.

  5. Step 5

    Place 6 shrimp in a line across the rice. Brush the nori edge with water.

  6. Step 6

    Roll tightly away from you using a bamboo mat. Drizzle with spicy mayo and serve.

Tools you’ll need

  • deep skillet
  • instant-read thermometer
  • paper towels
  • small bowl
  • bamboo sushi mat
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.