Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Snow Cheese Fried Chicken

Juicy Korean fried chicken coated in a tangy-sweet cheese powder sauce, ready in 20 minutes. Serve with a creamy dipping sauce for that signature snow cheese vibe.

Total time
20 min
Servings
2
Calories
620
Protein
48g
Crispy Snow Cheese Fried Chicken
indulgentcasualkoreanchickencrispytendercreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry and season with salt and pepper. Toss with flour until coated.

  2. Step 2

    Heat 2 tbsp neutral oil in a large skillet over medium-high until shimmering.

  3. Step 3

    Add chicken and sear 6–7 minutes per side until golden and cooked through. Remove to a plate.

  4. Step 4

    In the same pan, reduce heat to medium and whisk together sour cream, honey, and vinegar until smooth.

  5. Step 5

    Stir in mozzarella off heat until melted and glossy. Return chicken to coat in sauce.

  6. Step 6

    Serve immediately with extra sauce on the side for dipping.

Tools you’ll need

  • 12-inch skillet
  • paper towels
  • whisk
  • kitchen thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.