Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Tlayudas with Refried Beans & Cheese

Oaxacan-style fried tortillas topped with refried beans, melted cheese, and fresh toppings. Crispy, savory, and ready in 20 minutes using a sheet pan.

Total time
20 min
Servings
2
Calories
385
Protein
12g
Crispy Tlayudas with Refried Beans & Cheese
casualsatisfyingmexicanvegetariancheesecrispymeltyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 400°F. Line a sheet pan with parchment paper.

  2. Step 2

    Brush both sides of each tortilla lightly with olive oil. Arrange on the sheet pan.

  3. Step 3

    Bake tortillas 5–6 minutes until they start to turn golden and crisp at edges.

  4. Step 4

    Remove pan from oven. Spread 3 tablespoons refried beans on each tortilla.

  5. Step 5

    Top each with 1/4 cup cheese. Return to oven for 4–5 minutes until cheese melts.

  6. Step 6

    Top tlayudas with diced tomato, sliced onion, salt, and pepper. Serve hot.

Tools you’ll need

  • sheet pan
  • parchment paper
  • oven
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.