Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheese & Spinach Fatayer

Flaky, hand-held Lebanese pastries stuffed with melted cheese and wilted spinach, baked golden in 18 minutes. Ready-made phyllo makes this a weeknight win.

Total time
18 min
Servings
4
Calories
285
Protein
10g
Crispy Cheese & Spinach Fatayer
casualsatisfyinglebanesemediterraneanvegetariancheesecrispyflaky

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 400°F. Toss spinach with salt, pepper, and a squeeze of lemon juice until wilted.

  2. Step 2

    Mix wilted spinach with feta and mozzarella in a bowl. Taste and adjust salt.

  3. Step 3

    Lay 1 phyllo sheet on a work surface, brush lightly with melted butter, then stack a second sheet on top.

  4. Step 4

    Spoon 2 tbsp filling onto the bottom left, fold into a triangle, then fold again until you reach the edge.

  5. Step 5

    Place fatayers seam-side down on a parchment-lined sheet pan. Brush tops with remaining butter.

  6. Step 6

    Bake until golden and crispy, 12–14 minutes. Sprinkle with sumac while hot. Serve immediately.

Tools you’ll need

  • oven
  • sheet pan
  • parchment paper
  • small bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.