Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Tomato Toast with Garlic Oil

Charred bread rubbed with garlic and topped with fresh tomato, fleur de sel, and Spanish olive oil. A TikTok-viral Spanish classic that feels fancy but takes 10 minutes.

Total time
10 min
Servings
2
Calories
195
Protein
4g
Crispy Tomato Toast with Garlic Oil
simplefreshspanishvegetariancrispytenderjuicyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a skillet over medium-high until it shimmers, about 90 seconds.

  2. Step 2

    Toast bread slices 90 seconds per side until edges char and surface turns golden.

  3. Step 3

    Rub each warm toast with a cut garlic clove, pressing gently so it dissolves into the bread.

  4. Step 4

    Cut tomatoes in half and squeeze halves over a small bowl to release juices, then roughly chop the flesh.

  5. Step 5

    Divide tomato onto toasts, drizzle with olive oil, and sprinkle with fleur de sel and black pepper.

  6. Step 6

    Tear basil over the top if using, then serve immediately.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • chef's knife
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.