Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Tostadas with Quick Toppings

Crunchy fried tortillas topped with refried beans, cheese, and fresh salsa in under 15 minutes. A satisfying snack or light meal that comes together faster than you'd expect.

Total time
12 min
Servings
2
Calories
385
Protein
9g
Crispy Tostadas with Quick Toppings
casualsatisfyingmexicanvegetariancrispymeltysnackweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a shallow skillet over medium-high until a tortilla sizzles immediately on contact, ~2 minutes.

  2. Step 2

    Fry tortillas one at a time, 45 seconds per side, until golden and crispy. Transfer to a paper towel.

  3. Step 3

    Spread 2 tablespoons warm refried beans on each tostada, pressing gently to adhere.

  4. Step 4

    Divide cheese evenly among tostadas. Top with 2 tablespoons salsa each.

  5. Step 5

    Serve immediately. Garnish with cilantro or serve with lime wedges if desired.

Tools you’ll need

  • shallow skillet or small sauté pan (8-10 inch)
  • tongs or slotted spoon
  • paper towels
  • knife and cutting board (for cilantro)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.