Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Tostones with Garlic Mojo

Twice-fried plantain rounds crispy outside, creamy inside, finished with a bright garlic-lime mojo. Pure Cuban comfort in under 25 minutes.

Total time
25 min
Servings
2
Calories
420
Protein
2g
Crispy Tostones with Garlic Mojo
satisfyingcomfortcubanvegetariandairy-freecrispycreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel plantains: cut off ends, score skin lengthwise, peel back. Slice into 1-inch rounds.

  2. Step 2

    Heat oil in a heavy skillet over medium-high until a plantain round sizzles instantly when dropped in.

  3. Step 3

    Working in batches, fry plantain rounds 2–3 minutes per side until golden. Transfer to a paper-towel-lined plate.

  4. Step 4

    Let cool for 1 minute. Flatten each round between two paper towels using the bottom of a glass or skillet.

  5. Step 5

    Fry flattened rounds again, 1–2 minutes per side, until deep golden and crispy. Drain on fresh paper towels.

  6. Step 6

    Pound garlic with salt until paste forms. Stir in juice from lime. Drizzle mojo over hot tostones, garnish with cilantro if desired.

Tools you’ll need

  • heavy-bottomed skillet or deep frying pan (12-inch minimum)
  • paper towels
  • slotted spoon or spider strainer
  • mortar and pestle (or small bowl and fork)
  • kitchen knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.