Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Falafel & Hummus Bowl

Golden, crispy falafel served over creamy hummus with fresh herbs and a drizzle of olive oil. Crunchy outside, fluffy inside—ready in under 25 minutes with canned chickpeas.

Total time
25 min
Servings
2
Calories
520
Protein
16g
Crispy Falafel & Hummus Bowl
satisfyingcasualmiddle-easternvegetarianveganchickpeascrispycreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pulse chickpeas with flour, cumin, 1 clove garlic, salt, and pepper until mixture holds together but is still crumbly, ~90 seconds.

  2. Step 2

    Heat 1 inch of neutral oil in a heavy skillet over medium-high until it shimmers, ~3 minutes.

  3. Step 3

    Scoop 1-tbsp portions of falafel mixture and flatten into small patties. Fry in batches without crowding, 2 minutes per side until deep golden.

  4. Step 4

    Whisk tahini with lemon juice, 1 clove minced garlic, salt, pepper, and 2 tbsp water until creamy. Spread on a plate or shallow bowl.

  5. Step 5

    Arrange warm falafel over hummus. Drizzle with olive oil and scatter parsley on top.

  6. Step 6

    Serve immediately with lemon wedges on the side.

Tools you’ll need

  • food processor
  • heavy skillet (10-12 inch)
  • instant-read thermometer (optional, oil should reach ~350°F)
  • slotted spoon
  • whisk
  • shallow bowl or plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.