Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Crispy Veggie Fajitas

Bell peppers and onions hit a screaming-hot skillet until charred and tender, then wrapped in warm tortillas with a lime crema and fresh cilantro. No beans, no rice—just pure fajita energy in under 10 minutes.

Total time
10 min
Servings
2
Calories
280
Protein
6g
10-Min Crispy Veggie Fajitas
quickcasualtex-mexvegetarianvegetariancrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Stir sour cream with lime juice, zest, salt, and pepper until smooth and creamy.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Add peppers and onion. Sprinkle with chili powder, salt, and pepper. Cook without stirring for 3 minutes until charred.

  4. Step 4

    Stir the vegetables and cook for 2 more minutes until edges curl and soften slightly.

  5. Step 5

    Warm tortillas in the skillet for 30 seconds per side, or in a dry skillet if you prefer.

  6. Step 6

    Fill tortillas with veggies, drizzle with lime crema, and top with fresh cilantro. Serve immediately.

Tools you’ll need

  • 12-inch skillet
  • small mixing bowl
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.