Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Yangnyeom Chicken Wings

Sheet-pan Korean wings with a sticky-spicy gochujang glaze, sesame seeds, and scallions. Broil for crispy skin, toss in the sauce, done in 25 minutes.

Total time
25 min
Servings
2
Calories
485
Protein
42g
Crispy Yangnyeom Chicken Wings
satisfyingcasualkoreanchickencrispytenderweeknightgame-day

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat wings dry with paper towels. Toss with salt, pepper, and a light drizzle of oil on a sheet pan.

  2. Step 2

    Broil 5 inches from heat for 12–14 minutes, shaking pan halfway through, until skin is crispy and golden.

  3. Step 3

    While wings broil, whisk gochujang, honey, soy sauce, vinegar, and garlic in a small bowl until smooth.

  4. Step 4

    Remove wings from broiler. Pour glaze over and toss until evenly coated.

  5. Step 5

    Return to broiler for 2–3 minutes until glaze is sticky and caramelized, watching to avoid burning.

  6. Step 6

    Top with sesame seeds and scallions. Serve hot with extra napkins.

Tools you’ll need

  • sheet pan (18×13 inch)
  • small mixing bowl
  • whisk
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.