Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Deep-Fried Taro Dumplings

Crispy golden taro dumplings with a savory mushroom-sesame filling, fried until the exterior shatters and the inside stays creamy. Serve with sweet-and-sour dipping sauce for the perfect vegetarian appetizer or light dinner.

Total time
45 min
Servings
4
Calories
320
Protein
4g
Deep-Fried Taro Dumplings
indulgentcelebrationchinesevegetarianvegetariancrispycreamyfluffy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut taro into 1-inch chunks. Steam in a covered pot until fork-tender, ~15 minutes.

  2. Step 2

    While taro cooks, sauté mushrooms in a skillet over medium-high until golden, ~5 minutes.

  3. Step 3

    Stir in scallions, sesame oil, and soy sauce. Cook 1 minute until fragrant. Set aside.

  4. Step 4

    Mash hot taro until smooth. Fold in cornstarch, then the mushroom mixture until combined.

  5. Step 5

    Let taro mixture cool 5 minutes, then scoop into 1.5-inch balls using two spoons.

  6. Step 6

    Heat oil in a heavy pot to 350°F. Fry dumplings in batches until deep golden, ~3 minutes.

  7. Step 7

    Transfer to a paper-towel-lined plate. Serve hot with soy sauce or sweet-and-sour dipping sauce.

Tools you’ll need

  • pot with cover for steaming
  • 12-inch skillet
  • wooden spoon
  • deep heavy pot or Dutch oven
  • instant-read thermometer
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.