Custrd is out on the App Store — Download it free →
Back to recipes

Donburi

A comforting Japanese rice bowl topped with crispy croquettes, crumbled meat or tofu, a runny egg yolk, and savory nori. This quick weeknight meal is customizable and satisfying.

Total time
30 min
Servings
2
Calories
650
Protein
25g
Donburi
comfortingJapanesebeefeggcrispycreamyweeknightrice bowl

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cook the croquettes according to package directions until golden and crispy, about 15 minutes in a 400°F oven or as directed.

  2. Step 2

    In a skillet over medium heat, cook the 0.5 pound ground beef or crumbled tofu until browned and cooked through, about 5-7 minutes. Add 2 tablespoons soy sauce and stir for 1 minute until absorbed.

  3. Step 3

    Divide the 2 cups cooked rice between two bowls. Top each with half of the meat mixture and 2 croquettes.

  4. Step 4

    Slice the 2 green onions thinly and cut the 1 sheet nori into thin strips. Sprinkle over the bowls along with 1 teaspoon sesame seeds.

  5. Step 5

    Carefully place one raw egg yolk on top of each bowl. Serve immediately, letting the yolk mix into the rice as you eat. Add ketchup or lemon if desired.

Tools you’ll need

  • skillet
  • baking sheet
  • knife
  • cutting board
  • bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.