Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Dutch Pannenkoeken with Caramelized Apples & Cinnamon

Thin, tender Dutch pancakes served warm with spiced caramelized apples and a dusting of powdered sugar. A cozy vegetarian dinner that feels elegant but comes together in under an hour.

Total time
45 min
Servings
4
Calories
380
Protein
8g
Dutch Pannenkoeken with Caramelized Apples & Cinnamon
comfortelegantdutchvegetarianeggstendercrispyweeknight

Ingredients

11 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour and salt in a large bowl. Make a well in the center.

  2. Step 2

    Crack eggs into the well. Pour milk around them. Whisk until smooth and thin, like heavy cream.

  3. Step 3

    Melt 1 tbsp butter and stir into batter. Let rest 15 minutes at room temperature.

  4. Step 4

    Melt 2 tbsp butter in a large skillet over medium. Add apple slices in a single layer.

  5. Step 5

    Sprinkle sugar and cinnamon over apples. Cook 8 minutes without stirring until golden at edges.

  6. Step 6

    Flip apples in batches. Cook 4 minutes until the second side browns and caramelizes.

  7. Step 7

    Drizzle lemon juice over apples. Stir gently for 30 seconds to coat. Transfer to a plate.

  8. Step 8

    Heat a 10-inch nonstick skillet or crepe pan over medium-high until a drop of water sizzles, ~1 minute.

  9. Step 9

    Add 0.5 tbsp butter. Tilt pan to coat evenly. Pour in 1/4 cup batter, immediately tilting to spread thin.

  10. Step 10

    Cook 60 seconds until the bottom is speckled light golden. Flip carefully with a thin spatula.

  11. Step 11

    Cook the second side 30 seconds until set but still tender. Slide onto a plate.

  12. Step 12

    Repeat with remaining batter (makes 8–10 pannenkoeken). Brush skillet with butter between batches.

  13. Step 13

    Stack warm pannenkoeken on a serving platter. Top with caramelized apples.

  14. Step 14

    Dust with powdered sugar and lemon zest. Serve immediately while still warm.

Tools you’ll need

  • 10-inch nonstick skillet or crepe pan
  • large bowl
  • whisk
  • thin metal spatula
  • measuring cups and spoons
  • vegetable peeler
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.