Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Egg & Cheese Croissant

A buttery croissant crisped in a skillet, filled with a fluffy scrambled egg and melted cheese. Ready in under 15 minutes.

Total time
12 min
Servings
1
Calories
385
Protein
13g
Egg & Cheese Croissant
casualquickamericanvegetarianeggscrispyfluffymelty

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Crack eggs into a bowl. Whisk with a fork until well combined.

  2. Step 2

    Slice the croissant horizontally. Melt 0.5 tbsp butter in a skillet over medium-high.

  3. Step 3

    Place croissant halves cut-side down in the skillet. Toast until golden and crispy, about 90 seconds.

  4. Step 4

    Transfer croissant halves to a plate. Add remaining 0.5 tbsp butter to the skillet.

  5. Step 5

    Pour in eggs. Let sit for 15 seconds, then gently push scrambled curds to the edge.

  6. Step 6

    Continue stirring until the eggs are soft and barely set, 90 seconds total. Season with salt and pepper.

  7. Step 7

    Top the bottom croissant half with scrambled eggs. Sprinkle cheese over warm eggs.

  8. Step 8

    Cover with the top croissant half. Serve immediately while the cheese melts.

Tools you’ll need

  • small bowl
  • fork
  • 10-inch non-stick or cast iron skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.