CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Egg & Cheese Croissant

A buttery croissant crisped in a skillet, filled with a fluffy scrambled egg and melted cheese. Ready in under 15 minutes.

Total time
12 min
Servings
1
Calories
385
Protein
13g
Egg & Cheese Croissant
casualquickamericanvegetarianeggscrispyfluffymelty

Ingredients

  • 1 whole croissant, fresh
  • 2 whole large eggs
  • ½ ounce cheddar cheese, sliced or shredded
  • 1 tbsp butter
  • 1 to taste salt and pepper

Instructions

  1. 1

    Crack eggs into a bowl. Whisk with a fork until well combined.

  2. 2

    Slice the croissant horizontally. Melt 0.5 tbsp butter in a skillet over medium-high.

  3. 3

    Place croissant halves cut-side down in the skillet. Toast until golden and crispy, about 90 seconds.

  4. 4

    Transfer croissant halves to a plate. Add remaining 0.5 tbsp butter to the skillet.

  5. 5

    Pour in eggs. Let sit for 15 seconds, then gently push scrambled curds to the edge.

  6. 6

    Continue stirring until the eggs are soft and barely set, 90 seconds total. Season with salt and pepper.

  7. 7

    Top the bottom croissant half with scrambled eggs. Sprinkle cheese over warm eggs.

  8. 8

    Cover with the top croissant half. Serve immediately while the cheese melts.

Tools you’ll need

  • small bowl
  • fork
  • 10-inch non-stick or cast iron skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.