Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Egg Rice Noodle Rolls

Silky scrambled eggs wrapped around chewy rice noodles with fresh vegetables and a savory dipping sauce. Ready in under 20 minutes—elegant enough for dinner, easy enough for weeknight cooking.

Total time
18 min
Servings
2
Calories
420
Protein
14g
Egg Rice Noodle Rolls
elegantsimplechinesevegetarianvegetariansilkychewyBread

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil rice noodles in salted water until just tender, about 4 minutes. Drain and set aside.

  2. Step 2

    Whisk eggs in a bowl with salt and white pepper until well beaten.

  3. Step 3

    Whisk soy sauce, sesame oil, and rice vinegar together in a small bowl for dipping sauce.

  4. Step 4

    Heat 1 tbsp neutral oil in a 12-inch nonstick skillet over medium-high heat until it shimmers.

  5. Step 5

    Pour in half the beaten egg and let it spread into a thin layer without stirring, ~30 seconds.

  6. Step 6

    Push the egg toward the center, tilting the pan so uncooked egg flows to the edges. Cook until set but still slightly wet on top, ~45 seconds.

  7. Step 7

    Slide the egg crepe onto a plate. Repeat with remaining 1 tbsp oil and egg for a second crepe.

  8. Step 8

    In the same skillet, sauté mushrooms over medium-high heat until golden, ~3 minutes. Add bean sprouts and scallions; toss 30 seconds until fragrant.

  9. Step 9

    Place one egg crepe on a cutting board. Layer half the noodles down the center, then half the vegetable mixture on top.

  10. Step 10

    Roll the crepe tightly around the filling, folding in the sides as you go. Repeat with the second crepe and remaining filling.

  11. Step 11

    Slice each roll diagonally into 4 pieces. Arrange on a plate and serve with dipping sauce on the side.

Tools you’ll need

  • 12-inch nonstick skillet
  • large pot for boiling noodles
  • small mixing bowl
  • whisk
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.