Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Classic Fettuccine Alfredo

Silky, butter-forward pasta with a luxurious Parmesan cream sauce made from just a handful of pantry staples. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
628
Protein
22g
Classic Fettuccine Alfredo
comfortelegantitalianvegetariancreamysilkytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large pot. Add fettuccine and cook until al dente, ~9 minutes. Reserve 0.5 cup pasta water, then drain.

  2. Step 2

    Melt butter in the same pot over medium heat. Add minced garlic and cook until fragrant, ~45 seconds.

  3. Step 3

    Pour in cream and bring to a gentle simmer, stirring occasionally, ~2 minutes.

  4. Step 4

    Remove from heat. Stir in Parmesan in batches until fully melted and sauce is smooth.

  5. Step 5

    Add cooked pasta to the sauce and toss, adding pasta water 1 tbsp at a time if too thick.

  6. Step 6

    Season with salt and pepper to taste. Serve immediately while hot.

Tools you’ll need

  • large pot
  • wooden spoon
  • colander
  • measuring cups and spoons
  • microplane or box grater

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.