Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Fish Amritsari

Crispy-coated fish from Punjab's sacred city, fried until golden and served with a squeeze of lemon. A street-food favorite that delivers big flavor in under 30 minutes.

Total time
25 min
Servings
2
Calories
280
Protein
28g
Fish Amritsari
casualsatisfyingindianfishcrispytenderweeknightappetizer

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the fish fillets dry using a clean paper towel or kitchen cloth, pressing gently on both sides to remove surface moisture so the coating will stick properly.

  2. Step 2

    In a small bowl, combine the ginger-garlic paste, red chili powder, 0.5 teaspoon salt, and 1/4 teaspoon black pepper with 2 tablespoons water, stirring until the spices form a thin, spreadable paste.

  3. Step 3

    Rub the spice paste evenly over both sides of each fish fillet, using your fingers to coat the entire surface; let rest on a plate for 5 minutes so flavors begin to penetrate the fish.

  4. Step 4

    Pour the flour and cornstarch into a shallow bowl or plate, add 0.25 teaspoon salt and 0.25 teaspoon black pepper, and stir with a fork until evenly mixed.

  5. Step 5

    Working with one fillet at a time, lay it in the flour mixture and press gently, then flip and press the other side, turning to coat every edge in a thin, even layer; shake off excess flour back into the bowl.

  6. Step 6

    Pour vegetable oil into a 10-inch skillet to a depth of 0.75 inch and heat over medium-high heat until a small piece of bread dropped into the oil sizzles immediately and rises to the surface, about 2 minutes.

  7. Step 7

    Carefully lay both coated fish fillets into the hot oil; listen for an immediate, steady sizzle. Do not move them for 3 minutes so the underside becomes golden brown.

  8. Step 8

    Using a thin metal spatula, carefully slide underneath each fillet and flip it over in one smooth motion, then fry the second side for 2 to 3 minutes until it also turns golden brown and the flesh looks opaque when you peek at the thickest part.

  9. Step 9

    Transfer the fried fish to a paper-towel-lined plate to drain excess oil for 1 minute, then slide onto a serving plate.

  10. Step 10

    Squeeze fresh lemon juice over the top of each fillet just before serving, and sprinkle with a pinch of chaat masala or red chili powder if desired.

Tools you’ll need

  • paper towels
  • small bowl
  • fork
  • shallow plate or bowl
  • 10-inch skillet
  • thermometer (optional, to verify oil temperature)
  • thin metal spatula
  • plate lined with paper towels
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.