Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Fish Chermoula

Pan-seared white fish coated in a vibrant Moroccan herb sauce of cilantro, parsley, garlic, lemon, and spices. Bright, garlicky, and ready in 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
38g
Fish Chermoula
freshelegantmoroccanfishtendercrispyweeknightdate-night

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Chop the cilantro and parsley into pieces about the size of your thumb, discarding any thick stems, and place them in a food processor bowl.

  2. Step 2

    Peel the garlic cloves and drop them whole into the food processor with the herbs.

  3. Step 3

    Pour in the lemon juice, 0.25 cup of olive oil, cumin, paprika, and a pinch each of salt and pepper.

  4. Step 4

    Pulse the food processor 8–10 times until the mixture becomes a chunky paste with visible herb flecks, not a smooth purée.

  5. Step 5

    Pat the fish fillets completely dry with a clean kitchen towel or paper towels.

  6. Step 6

    Place a 10-inch nonstick or regular skillet over medium-high heat and pour in 1 tablespoon of olive oil.

  7. Step 7

    Wait until the oil shimmers and slides quickly when you tilt the pan, about 90 seconds.

  8. Step 8

    Carefully lay each fish fillet skin-side down (or presentation-side down) in the hot oil, working away from your body to avoid splashes.

  9. Step 9

    Cook without moving the fish for 4–5 minutes until the bottom turns opaque and the edges begin to look cooked through.

  10. Step 10

    Using a thin metal spatula, flip each fillet carefully and cook the other side for 2–3 minutes until it flakes easily when poked with a fork.

  11. Step 11

    Transfer each fish fillet to a serving plate.

  12. Step 12

    Spoon half of the chermoula sauce in a generous coat over each fillet, covering the top and letting some drip down the sides.

Tools you’ll need

  • food processor
  • 10-inch skillet (nonstick or regular)
  • paper towels or clean kitchen towel
  • thin metal spatula
  • 2 serving plates
  • fork (for testing doneness)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.