Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Moroccan Stuffed Sardines

Whole fresh sardines stuffed with a fragrant paste of cilantro, garlic, and warm spices, then pan-fried until crispy. A vibrant, elegant dish ready in 20 minutes.

Total time
20 min
Servings
2
Calories
320
Protein
28g
Moroccan Stuffed Sardines
elegantfreshmoroccanfishcrispytenderweeknightdate-night

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mince the garlic until the pieces are the size of pencil-tip dots, smaller than a grain of rice.

  2. Step 2

    Chop the cilantro leaves roughly into pieces about the size of your fingernail — no need for fine uniformity.

  3. Step 3

    In a small bowl, stir together the minced garlic, chopped cilantro, cumin, paprika, and a pinch of salt and pepper until the mixture looks uniform and fragrant.

  4. Step 4

    Pat each sardine dry inside and out with a clean kitchen towel or paper towels, working gently to avoid tearing the skin.

  5. Step 5

    Spoon about 1 teaspoon of the cilantro-garlic filling into the cavity of each sardine, dividing it evenly among the four fish.

  6. Step 6

    Heat 3 tablespoons of olive oil in a 12-inch skillet over medium-high heat until the oil shimmers and slides quickly when you tilt the pan, about 90 seconds.

  7. Step 7

    Lay the stuffed sardines flat in the hot oil in a single layer, without crowding; you should hear an immediate, steady sizzle.

  8. Step 8

    Cook without moving them for 2 minutes, until the skin begins to look golden and the edges darken slightly.

  9. Step 9

    Using a thin metal spatula, carefully slide it under each sardine and flip it over in one smooth motion.

  10. Step 10

    Cook the second side for another 2 minutes, until the skin is golden all over and the fish feels firm to a gentle prod with your finger.

  11. Step 11

    Transfer the sardines to a serving plate and taste a small piece; add a pinch more salt if needed.

Tools you’ll need

  • small mixing bowl
  • 12-inch skillet
  • thin metal spatula
  • paper towels
  • teaspoon
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.