Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Focaccia al Rosmarino

A classic Italian flatbread with a tender crumb and crispy, dimpled surface topped with rosemary and coarse salt. Ready in 30 minutes using store-bought dough and a simple sheet-pan method.

Total time
30 min
Servings
8
Calories
156
Protein
4g
Focaccia al Rosmarino
rusticsimpleitalianvegancrispyfluffyairyBread

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 425°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. Step 2

    Pour 2 tablespoons of olive oil onto a 13-by-18-inch sheet pan and spread it evenly with your fingers until the entire bottom surface is lightly coated.

  3. Step 3

    Place the thawed dough in the center of the oiled pan and press it gently with your fingertips, stretching it toward the corners until it fills the entire pan in a single, even layer, about 1/4-inch thick.

  4. Step 4

    Strip the rosemary leaves from their stems by pinching the top of each stem and sliding your fingers downward; discard the woody stems and leave the leaves in a small pile.

  5. Step 5

    Drizzle the remaining 1 tablespoon of olive oil evenly over the dough surface in a thin zigzag pattern.

  6. Step 6

    Sprinkle the coarse sea salt and black pepper evenly across the entire dough, using your eyes to distribute them so no area looks bare or over-salted.

  7. Step 7

    Scatter the rosemary leaves evenly over the top, pressing them gently into the dough with your fingertips so they stick.

  8. Step 8

    Use your fingertip to press dimples all over the dough surface, spacing them about 1 inch apart and pushing down until each dimple is about 1/4-inch deep, creating a pattern like a quilted blanket.

  9. Step 9

    Place the sheet pan in the preheated oven and bake for 12–15 minutes, until the focaccia is golden brown on top and the edges are a shade darker, like honey.

  10. Step 10

    Remove the pan from the oven using oven mitts and let the focaccia cool on the pan for 2–3 minutes before slicing and serving warm.

Tools you’ll need

  • oven
  • 13-by-18-inch sheet pan
  • oven mitts
  • small bowl (for rosemary)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.