Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Focaccia with Herbs & Olives

A TikTok-easy vegan focaccia inspired by Provençal flavors, made with store-bought dough and finished with rosemary, garlic, and briny olives. Sheet-pan bake, 15 minutes total.

Total time
18 min
Servings
4
Calories
285
Protein
6g
Sheet-Pan Focaccia with Herbs & Olives
rusticsimplefrenchmediterraneanvegandairy-freecrispyfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Line a sheet pan with parchment paper.

  2. Step 2

    Stretch dough to fill the pan, pressing gently with oiled fingertips until even thickness.

  3. Step 3

    Drizzle 2 tbsp olive oil over dough. Scatter minced garlic and rosemary across the surface.

  4. Step 4

    Press olives into the dough, spacing them evenly. Drizzle final tbsp of oil over top.

  5. Step 5

    Bake 12–15 minutes until golden and edges pull away from pan sides slightly.

  6. Step 6

    Scatter fleur de sel over hot focaccia. Cool 2 minutes, slice, and serve warm.

Tools you’ll need

  • sheet pan
  • parchment paper
  • oven (425°F)
  • small bowl for oil

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.