Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Fresh Ricotta Ravioli with Brown Butter

Tender homemade ravioli filled with creamy ricotta and finished with nutty brown butter and sage. Ready in under 30 minutes with just six ingredients.

Total time
25 min
Servings
2
Calories
520
Protein
20g
Fresh Ricotta Ravioli with Brown Butter
elegantcomfortitalianvegetarianvegetariantendercreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Combine ricotta, egg, parmesan, and a pinch of salt in a bowl. Stir until smooth.

  2. Step 2

    Spoon 1 tbsp filling into the center of a wonton wrapper.

  3. Step 3

    Wet the wrapper edges with water. Fold into a triangle, then bring corners together to form a purse. Repeat with remaining wrappers.

  4. Step 4

    Bring a pot of salted water to a boil. Add ravioli and cook until they float, then 1 minute more.

  5. Step 5

    While ravioli cook, heat butter in a skillet over medium. Add sage and cook until butter turns golden brown, ~3 minutes.

  6. Step 6

    Drain ravioli and add to brown butter. Toss gently. Divide between bowls and serve hot.

Tools you’ll need

  • medium bowl
  • spoon
  • pot (3-quart minimum)
  • skillet (10-inch)
  • slotted spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.