Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Homemade Ricotta Ravioli

Hand-rolled pasta parcels filled with creamy ricotta and fresh herbs, finished with brown butter and sage. Restaurant-quality in 45 minutes with minimal equipment.

Total time
45 min
Servings
4
Calories
520
Protein
18g
Homemade Ricotta Ravioli
elegantcomfortitalianvegetariancheesetendercreamyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mound flour on a clean counter. Make a well in the center and crack 2 eggs into it.

  2. Step 2

    Fork the eggs and gradually pull flour into the center until a shaggy dough forms.

  3. Step 3

    Knead the dough for 8 minutes until smooth and elastic. Wrap in plastic and rest 15 minutes.

  4. Step 4

    Mix ricotta, Parm, herbs, 1 remaining egg, salt, and pepper in a bowl until combined.

  5. Step 5

    Roll dough on floured surface to 1/8-inch thick. Cut 3-inch squares with a knife or cutter.

  6. Step 6

    Place 1 tbsp filling in center of each square. Fold into a triangle and press edges to seal.

  7. Step 7

    Bring salted water to a boil in a large pot. Add ravioli and cook until they float, then 2 more minutes.

  8. Step 8

    Brown butter in a skillet over medium heat until it foams and turns golden, ~3 minutes.

  9. Step 9

    Add sage leaves to brown butter and let crisp for 30 seconds. Remove with a slotted spoon.

  10. Step 10

    Drain ravioli, reserving 1/4 cup pasta water. Transfer to the skillet with brown butter.

  11. Step 11

    Toss gently with reserved pasta water until ravioli are coated. Season with salt and pepper.

  12. Step 12

    Plate ravioli, drizzle with brown butter sauce, top with crispy sage, and serve immediately.

Tools you’ll need

  • cutting board
  • fork
  • plastic wrap
  • ruler or rolling pin
  • knife or 3-inch ravioli cutter
  • large pot
  • slotted spoon
  • 10-inch skillet
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.