CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Homemade Ricotta Ravioli

Hand-rolled pasta parcels filled with creamy ricotta and fresh herbs, finished with brown butter and sage. Restaurant-quality in 45 minutes with minimal equipment.

Total time
45 min
Servings
4
Calories
520
Protein
18g
Homemade Ricotta Ravioli
elegantcomfortitalianvegetariancheesetendercreamyweeknight

Ingredients

  • 2 cups all-purpose flour
  • 3 whole eggs
  • 1 cup whole milk ricotta
  • ½ cup Parmigiano-Reggiano, finely grated
  • 3 tbsp fresh parsley and basil, finely chopped
  • 4 tbsp butter
  • 8 leaves fresh sage leaves
  • 1 to taste salt and black pepper

Instructions

  1. 1

    Mound flour on a clean counter. Make a well in the center and crack 2 eggs into it.

  2. 2

    Fork the eggs and gradually pull flour into the center until a shaggy dough forms.

  3. 3

    Knead the dough for 8 minutes until smooth and elastic. Wrap in plastic and rest 15 minutes.

  4. 4

    Mix ricotta, Parm, herbs, 1 remaining egg, salt, and pepper in a bowl until combined.

  5. 5

    Roll dough on floured surface to 1/8-inch thick. Cut 3-inch squares with a knife or cutter.

  6. 6

    Place 1 tbsp filling in center of each square. Fold into a triangle and press edges to seal.

  7. 7

    Bring salted water to a boil in a large pot. Add ravioli and cook until they float, then 2 more minutes.

  8. 8

    Brown butter in a skillet over medium heat until it foams and turns golden, ~3 minutes.

  9. 9

    Add sage leaves to brown butter and let crisp for 30 seconds. Remove with a slotted spoon.

  10. 10

    Drain ravioli, reserving 1/4 cup pasta water. Transfer to the skillet with brown butter.

  11. 11

    Toss gently with reserved pasta water until ravioli are coated. Season with salt and pepper.

  12. 12

    Plate ravioli, drizzle with brown butter sauce, top with crispy sage, and serve immediately.

Tools you’ll need

  • cutting board
  • fork
  • plastic wrap
  • ruler or rolling pin
  • knife or 3-inch ravioli cutter
  • large pot
  • slotted spoon
  • 10-inch skillet
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.