Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Fresh Shrimp Summer Rolls

Springy rice paper wraps filled with cold poached shrimp, herbs, and crisp vegetables. Serve with a tangy fish sauce dipping sauce—no cooking skills required, just assembly.

Total time
20 min
Servings
2
Calories
156
Protein
18g
Fresh Shrimp Summer Rolls
freshlightsimplevietnamesedairy-freegluten-freeshrimptender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a pot of salted water to a boil. Add shrimp and cook until pink and opaque, 2-3 minutes. Drain and let cool.

  2. Step 2

    Fill a shallow bowl with warm water. Dip one rice paper wrapper for 3-4 seconds until pliable, then lay on a clean surface.

  3. Step 3

    Arrange a small handful of herbs and cucumber in the center, top with one shrimp halved lengthwise, then roll tightly into a cylinder, tucking in the sides as you go.

  4. Step 4

    Repeat with remaining wrappers, herbs, cucumber, and shrimp until all are filled.

  5. Step 5

    Whisk fish sauce, lime juice, and 2 tbsp water in a small bowl until combined. Taste and adjust.

  6. Step 6

    Serve rolls at room temperature with fish sauce dipping sauce on the side.

Tools you’ll need

  • large pot
  • shallow bowl (for water bath)
  • cutting board
  • sharp knife
  • small bowl (for sauce)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.