Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Fresh Spring Rolls with Peanut Sauce

Chewy rice paper wraps filled with fresh vegetables, herbs, and vermicelli noodles, served with a creamy peanut dipping sauce. Ready in 30 minutes.

Total time
30 min
Servings
4
Calories
280
Protein
9g
Fresh Spring Rolls with Peanut Sauce
freshlightvietnamesevegetarianveganvegetarianchewycrunchy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cook vermicelli in boiling salted water until tender, about 4 minutes. Drain and rinse with cold water.

  2. Step 2

    Slice cucumber and carrots into thin matchsticks about 2 inches long.

  3. Step 3

    Make peanut sauce: whisk peanut butter, lime juice, fish sauce, and 3 tbsp water until smooth.

  4. Step 4

    Fill a shallow bowl with warm water. Dip one rice paper wrapper in water for 3 seconds until pliable.

  5. Step 5

    Lay wrapper on a clean cutting board. Arrange a small handful of noodles, cucumber, carrots, and herbs in center.

  6. Step 6

    Fold the bottom edge over the filling, then fold in the sides and roll tightly to seal.

  7. Step 7

    Repeat with remaining wrappers and fillings. Arrange seam-side down on a platter.

  8. Step 8

    Serve rolls with peanut sauce on the side for dipping.

Tools you’ll need

  • large pot
  • shallow bowl for water
  • cutting board
  • sharp knife
  • whisk or spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.