Custrd is out on the App Store — Download it free →
Back to recipes

Fried Fish with Chutney

Crispy golden fish fillets served with two vibrant chutneys – a cool green cilantro dip and a tangy red tamarind sauce. A quick, flavorful weeknight dinner that feels special.

Total time
30 min
Servings
4
Calories
320
Protein
35g
Fried Fish with Chutney
comfortingsavoryindiangluten-freefishcrispyflakyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a bowl, mix 1/2 cup yogurt, 1 tsp turmeric, 1 tsp chili powder, and 1 tsp salt. Add 1.5 lb fish fillets, coat well, and let marinate for 10 minutes.

  2. Step 2

    While fish marinates, blend 1 cup cilantro with 2 tbsp water and a pinch of salt until smooth to make the green chutney. Set aside.

  3. Step 3

    In a small bowl, stir 2 tbsp tamarind paste with 2 tbsp water to make the red chutney. Set aside.

  4. Step 4

    Heat 3 tbsp oil in a large skillet over medium-high heat. Place the marinated fish in a single layer, not crowding the pan.

  5. Step 5

    Fry the fish until golden and crisp on the bottom, about 4 minutes. Flip and cook until opaque and flaky, about 3 more minutes.

  6. Step 6

    Serve the fried fish hot with the green and red chutneys on the side.

Tools you’ll need

  • large skillet
  • mixing bowl
  • blender or food processor
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.