Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Frozen Chocolate Banana Pops

Creamy frozen banana dipped in melted chocolate and hardened in minutes. A no-bake snack that tastes like ice cream on a stick.

Total time
10 min
Servings
4
Calories
185
Protein
2g
Frozen Chocolate Banana Pops
simplequickvegetariancreamycrispysnacksummerfrozen

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut bananas in half crosswise. Insert a popsicle stick or skewer into each flat end.

  2. Step 2

    Arrange banana pops on a parchment-lined baking sheet. Freeze for 5 minutes.

  3. Step 3

    Combine chocolate and coconut oil in a small microwave-safe bowl. Microwave in 20-second bursts, stirring between, until smooth.

  4. Step 4

    Working quickly, dip each frozen banana into warm chocolate, coating all sides. Let excess drip off.

  5. Step 5

    If using toppings, sprinkle them onto chocolate before it sets. Return to freezer.

  6. Step 6

    Freeze until chocolate hardens, 2–3 minutes. Serve immediately or store in freezer for up to 2 days.

Tools you’ll need

  • popsicle sticks or wooden skewers
  • baking sheet
  • parchment paper
  • small microwave-safe bowl
  • spoon or fork for dipping

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.