Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Ful Medames Sandwich

Creamy Egyptian fava bean dip on warm pita, topped with fresh tomato, onion, and a drizzle of olive oil. Ready in 10 minutes—no cooking required.

Total time
10 min
Servings
2
Calories
380
Protein
14g
Ful Medames Sandwich
casualfreshegyptianmediterraneanvegetarianveganbeanscreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mash fava beans with a fork until chunky-creamy, leaving some texture.

  2. Step 2

    Stir in 2 tbsp olive oil and lemon juice. Season with salt and pepper to taste.

  3. Step 3

    Warm pita in a dry skillet 30 seconds per side until soft and pliable.

  4. Step 4

    Spread ful mixture into each pita, dividing evenly between the two.

  5. Step 5

    Top with tomato and red onion. Drizzle remaining 1 tbsp olive oil over top.

  6. Step 6

    Serve immediately.

Tools you’ll need

  • fork
  • small bowl
  • 12-inch skillet

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.