Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Grilled Veggie Hummus Wrap

Warm tortilla stuffed with creamy hummus, charred vegetables, and fresh greens, pressed until golden and served with a zingy tahini dip. A Mediterranean weeknight wrap that tastes like it came from a café.

Total time
18 min
Servings
2
Calories
385
Protein
12g
Crispy Grilled Veggie Hummus Wrap
freshquickcasualmediterraneanvegetarianveganchickpeascrispy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice zucchini lengthwise into 1/4-inch planks. Slice bell pepper into wide strips. Thinly slice red onion.

  2. Step 2

    Heat a skillet over medium-high until it shimmers, about 2 minutes. Brush vegetables lightly with oil and salt.

  3. Step 3

    Grill vegetables in batches 2–3 minutes per side until charred and tender. Transfer to a plate.

  4. Step 4

    Spread hummus on the inside of each tortilla. Layer with greens, then grilled vegetables.

  5. Step 5

    Roll each tortilla tightly. Wipe the skillet and place wraps seam-side down. Cook 90 seconds per side until golden.

  6. Step 6

    Whisk tahini, lemon juice, lemon zest, and 2 tbsp water until smooth. Serve wraps with dipping sauce and side salad.

Tools you’ll need

  • 12-inch skillet or griddle
  • cutting board
  • chef's knife
  • small bowl for tahini sauce
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.