CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Garlic Butter Chicken & Rice

Sear chicken thighs, then build a fluffy one-pan rice directly in the same skillet with chicken broth and aromatics. Crispy edges, tender meat, no dishes.

Total time
25 min
Servings
4
Calories
620
Protein
38g
Garlic Butter Chicken & Rice
comfortsimpleamericanchickencrispytenderfluffyweeknight

Ingredients

  • 1.5 lbs boneless chicken thighs
  • 1.5 cups long-grain white rice
  • 3 cups chicken broth
  • 3 tbsp butter
  • 4 cloves garlic, minced
  • ½ cup dry white wine or apple cider vinegar
  • 3 sprigs fresh thyme or rosemary sprigs

Instructions

  1. 1

    Pat chicken dry. Season with salt and pepper on both sides.

  2. 2

    Heat 1 tbsp butter in a 12-inch skillet over medium-high until it foams. Sear chicken 4 minutes per side until golden. Transfer to a plate.

  3. 3

    Add remaining 2 tbsp butter and garlic to the skillet. Stir until fragrant, about 30 seconds.

  4. 4

    Pour in wine and scrape up any brown bits from the pan bottom. Let it bubble for 1 minute.

  5. 5

    Stir in rice until coated. Pour broth over, nestle chicken thighs back in, add herb sprigs, and bring to a boil.

  6. 6

    Cover, reduce heat to low, and simmer 12 minutes until rice is tender and liquid absorbs. Fluff with a fork. Serve hot.

Tools you’ll need

  • 12-inch skillet or large heavy pan with a tight-fitting lid
  • wooden spoon
  • meat thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.