Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Garlic Butter Chicken & Rice

Sear chicken thighs, then build a fluffy one-pan rice directly in the same skillet with chicken broth and aromatics. Crispy edges, tender meat, no dishes.

Total time
25 min
Servings
4
Calories
620
Protein
38g
Garlic Butter Chicken & Rice
comfortsimpleamericanchickencrispytenderfluffyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry. Season with salt and pepper on both sides.

  2. Step 2

    Heat 1 tbsp butter in a 12-inch skillet over medium-high until it foams. Sear chicken 4 minutes per side until golden. Transfer to a plate.

  3. Step 3

    Add remaining 2 tbsp butter and garlic to the skillet. Stir until fragrant, about 30 seconds.

  4. Step 4

    Pour in wine and scrape up any brown bits from the pan bottom. Let it bubble for 1 minute.

  5. Step 5

    Stir in rice until coated. Pour broth over, nestle chicken thighs back in, add herb sprigs, and bring to a boil.

  6. Step 6

    Cover, reduce heat to low, and simmer 12 minutes until rice is tender and liquid absorbs. Fluff with a fork. Serve hot.

Tools you’ll need

  • 12-inch skillet or large heavy pan with a tight-fitting lid
  • wooden spoon
  • meat thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.