CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Garlic Butter Mozzarella Grilled Cheese

Crispy-edged bread stuffed with melty mozzarella and brushed with garlicky butter—no dairy-heavy sauces, just pure cheesy comfort. Ready in under 10 minutes.

Total time
8 min
Servings
2
Calories
340
Protein
12g
Garlic Butter Mozzarella Grilled Cheese
comfortsimpleamericanvegetariancheesecrispymeltyweeknight

Ingredients

  • 4 slices bread
  • 4 oz mozzarella cheese
  • 2 tbsp butter
  • ½ tsp garlic powder

Instructions

  1. 1

    Mix softened butter with garlic powder until fragrant.

  2. 2

    Spread garlic butter on one side of each bread slice.

  3. 3

    Layer mozzarella between two slices, butter-side out on both sides.

  4. 4

    Heat a skillet over medium-high until a drop of water sizzles immediately.

  5. 5

    Sear sandwiches 2-3 minutes per side until golden brown and cheese melts.

  6. 6

    Serve hot immediately.

Tools you’ll need

  • 8-inch or 10-inch skillet
  • butter knife or small spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.