Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Garlic Butter Mozzarella Grilled Cheese

Crispy-edged bread stuffed with melty mozzarella and brushed with garlicky butter—no dairy-heavy sauces, just pure cheesy comfort. Ready in under 10 minutes.

Total time
8 min
Servings
2
Calories
340
Protein
12g
Garlic Butter Mozzarella Grilled Cheese
comfortsimpleamericanvegetariancheesecrispymeltyweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix softened butter with garlic powder until fragrant.

  2. Step 2

    Spread garlic butter on one side of each bread slice.

  3. Step 3

    Layer mozzarella between two slices, butter-side out on both sides.

  4. Step 4

    Heat a skillet over medium-high until a drop of water sizzles immediately.

  5. Step 5

    Sear sandwiches 2-3 minutes per side until golden brown and cheese melts.

  6. Step 6

    Serve hot immediately.

Tools you’ll need

  • 8-inch or 10-inch skillet
  • butter knife or small spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.