Garlic Cauliflower Rice Skillet
A one-pan cauliflower rice base loaded with stir-fried asparagus, seasoned ground meat, and bell peppers. Garlicky, savory, and on the table in under 20 minutes.
- Total time
- 18 min
- Servings
- 2
- Calories
- 285
- Protein
- 22g

quicksatisfyingamericanbeefcrispytenderweeknightstir-fry
Ingredients
- 3 cups cauliflower, riced (fresh or frozen)
- 2 tbsp olive oil
- 3 cloves garlic, minced
- ½ tsp salt
Instructions
- 1
Heat olive oil in a large skillet over medium-high until shimmering.
- 2
Add minced garlic and stir for 30 seconds until fragrant.
- 3
Pour in cauliflower rice and stir constantly for 4 minutes until edges start to brown.
- 4
Add ground meat, asparagus, and bell peppers; stir for 5 minutes until meat is cooked through.
- 5
Season with salt and pepper to taste, then serve hot.
Tools you’ll need
- large skillet (12-inch preferred)
- wooden spoon or silicone spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



