Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Garlic Cauliflower Rice Skillet

A one-pan cauliflower rice base loaded with stir-fried asparagus, seasoned ground meat, and bell peppers. Garlicky, savory, and on the table in under 20 minutes.

Total time
18 min
Servings
2
Calories
285
Protein
22g
Garlic Cauliflower Rice Skillet
quicksatisfyingamericanbeefcrispytenderweeknightstir-fry

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat olive oil in a large skillet over medium-high until shimmering.

  2. Step 2

    Add minced garlic and stir for 30 seconds until fragrant.

  3. Step 3

    Pour in cauliflower rice and stir constantly for 4 minutes until edges start to brown.

  4. Step 4

    Add ground meat, asparagus, and bell peppers; stir for 5 minutes until meat is cooked through.

  5. Step 5

    Season with salt and pepper to taste, then serve hot.

Tools you’ll need

  • large skillet (12-inch preferred)
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.