CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Garlic Cauliflower Rice Skillet

A one-pan cauliflower rice base loaded with stir-fried asparagus, seasoned ground meat, and bell peppers. Garlicky, savory, and on the table in under 20 minutes.

Total time
18 min
Servings
2
Calories
285
Protein
22g
Garlic Cauliflower Rice Skillet
quicksatisfyingamericanbeefcrispytenderweeknightstir-fry

Ingredients

  • 3 cups cauliflower, riced (fresh or frozen)
  • 2 tbsp olive oil
  • 3 cloves garlic, minced
  • ½ tsp salt

Instructions

  1. 1

    Heat olive oil in a large skillet over medium-high until shimmering.

  2. 2

    Add minced garlic and stir for 30 seconds until fragrant.

  3. 3

    Pour in cauliflower rice and stir constantly for 4 minutes until edges start to brown.

  4. 4

    Add ground meat, asparagus, and bell peppers; stir for 5 minutes until meat is cooked through.

  5. 5

    Season with salt and pepper to taste, then serve hot.

Tools you’ll need

  • large skillet (12-inch preferred)
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.