CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Min Beef & Broccoli Stir-Fry

Seared steak bites with broccoli in a garlicky soy glaze—real stir-fry speed, no takeout required. Hot skillet, four ingredients, dinner in under 5 minutes.

Total time
15 min
Servings
2
Calories
380
Protein
38g
15-Min Beef & Broccoli Stir-Fry
quicksatisfyingamericanbeefcrispytenderweeknightstir-fry

Ingredients

  • ¾ lb steak (sirloin or flank), sliced thin against the grain
  • 3 cups broccoli, cut into small florets
  • 3 tbsp soy sauce
  • 3 cloves garlic, minced

Instructions

  1. 1

    Heat 1 tbsp oil in a large skillet over high heat until it barely smokes.

  2. 2

    Add steak in a single layer and let it sear 90 seconds without stirring, then flip and cook 60 seconds until edges brown.

  3. 3

    Push steak to the side, add broccoli and garlic to the pan, and stir constantly until broccoli is bright green and tender, about 3 minutes.

  4. 4

    Pour soy sauce over everything, toss until coated, then cook 30 more seconds until the pan sizzles and everything is hot.

  5. 5

    Serve immediately in bowls or over rice.

Tools you’ll need

  • 12-inch skillet or wok
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.