Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Beef & Broccoli Stir-Fry

Seared steak bites with broccoli in a garlicky soy glaze—real stir-fry speed, no takeout required. Hot skillet, four ingredients, dinner in under 5 minutes.

Total time
15 min
Servings
2
Calories
380
Protein
38g
15-Min Beef & Broccoli Stir-Fry
quicksatisfyingamericanbeefcrispytenderweeknightstir-fry

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a large skillet over high heat until it barely smokes.

  2. Step 2

    Add steak in a single layer and let it sear 90 seconds without stirring, then flip and cook 60 seconds until edges brown.

  3. Step 3

    Push steak to the side, add broccoli and garlic to the pan, and stir constantly until broccoli is bright green and tender, about 3 minutes.

  4. Step 4

    Pour soy sauce over everything, toss until coated, then cook 30 more seconds until the pan sizzles and everything is hot.

  5. Step 5

    Serve immediately in bowls or over rice.

Tools you’ll need

  • 12-inch skillet or wok
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.