Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Garlic Fries San Francisco

Crispy oven-baked fries tossed with garlic, herbs, and a touch of vinegar for that iconic San Francisco flavor. Ready in under 25 minutes with minimal cleanup.

Total time
25 min
Servings
2
Calories
285
Protein
4g
Garlic Fries San Francisco
comfortsimplecalifornianvegetarianvegancrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 425°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. Step 2

    Scrub the potatoes under cold running water with a vegetable brush to remove any dirt, then pat them dry with a clean kitchen towel.

  3. Step 3

    Place each potato on a cutting board and cut lengthwise into 1/4-inch-thick slabs, like slicing bread; then cut each slab lengthwise into 1/4-inch-thick fries, similar to the thickness of a pencil.

  4. Step 4

    Place the cut fries in a large bowl, drizzle with 3 tablespoons olive oil, sprinkle with salt and pepper, and toss with your hands until every piece is evenly coated.

  5. Step 5

    Spread the fries in a single layer on a sheet pan, leaving no overlaps so they roast instead of steam, then place the pan in the preheated oven.

  6. Step 6

    Roast for 15–18 minutes, stirring the fries once halfway through (at about 8 minutes), until the surface turns the color of warm honey and the edges are slightly darker.

  7. Step 7

    While the fries roast, mince the garlic until the pieces are smaller than a grain of rice—about the size of pencil-tip dots.

  8. Step 8

    Remove the sheet pan from the oven and immediately sprinkle the minced garlic over the hot fries, stirring quickly to distribute it evenly.

  9. Step 9

    Drizzle 1 tablespoon red wine vinegar over the fries and stir to coat.

  10. Step 10

    Scatter 2 tablespoons chopped parsley over the top and toss once more, then taste and adjust salt and pepper as needed.

Tools you’ll need

  • oven
  • sheet pan
  • large mixing bowl
  • vegetable brush
  • cutting board
  • sharp chef's knife
  • kitchen towel

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.