Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Garlic Fries San Francisco

Crispy oven-baked fries tossed with garlic-infused oil, fresh parsley, and parmesan—a vegetarian take on the Bay Area classic. Ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
12g
Garlic Fries San Francisco
comfortsimplecalifornianvegetariancrispyweeknightcasualside

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 425°F and wait for the indicator light or beep to signal it has finished preheating, about 10 minutes.

  2. Step 2

    Rinse the potato under cold running water and scrub the skin with a vegetable brush or clean cloth to remove all dirt.

  3. Step 3

    Place the potato on a cutting board and slice it lengthwise into 1/4-inch-thick planks, like cutting bread; discard the rounded edges.

  4. Step 4

    Stack each plank and cut it lengthwise into 1/4-inch-thick batons—like french fry sticks—so each piece is about 3 inches long.

  5. Step 5

    Place the potato batons in a large bowl, pour 2 tablespoons of the olive oil over them, sprinkle with salt and pepper, and toss with your hands until every piece is coated.

  6. Step 6

    Spread the oiled fries in a single layer on a sheet pan, leaving no overlap; transfer to the preheated oven.

  7. Step 7

    Roast for 18–20 minutes, stirring the fries halfway through at the 9-minute mark, until the surface is golden brown and crispy at the edges.

  8. Step 8

    Remove the pan from the oven and set it on a heat-safe surface or trivet so you do not burn your hands.

  9. Step 9

    Pour the remaining 1 tablespoon of olive oil into a small bowl, add the minced garlic, and stir with a spoon until combined.

  10. Step 10

    Pour the garlic oil over the hot fries in the pan and toss gently with a spatula or spoon until every fry is coated.

  11. Step 11

    Sprinkle the fresh parsley and parmesan cheese evenly over the fries, then toss one more time to distribute.

  12. Step 12

    Divide the fries between two bowls or plates and serve immediately while still hot and crispy.

Tools you’ll need

  • oven
  • vegetable brush
  • cutting board
  • chef's knife
  • large mixing bowl
  • sheet pan
  • small bowl
  • spoon
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.