Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Garlic Parmesan Fries

Frozen fries crisped in the oven, then tossed with melted garlic butter and a shower of sharp Parmesan and fresh parsley. Ready in 20 minutes—the perfect salty, savory side that doubles as dinner.

Total time
20 min
Servings
2
Calories
380
Protein
11g
Crispy Garlic Parmesan Fries
comfortquickamericanvegetariancrispyweeknightsidedinner

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Spread frozen fries on a sheet pan and bake at 400°F until golden and crispy, 18–20 minutes.

  2. Step 2

    While fries bake, warm oil in a small skillet over medium and cook minced garlic until fragrant, about 1 minute.

  3. Step 3

    Transfer hot fries to a large bowl and pour the warm garlic oil over them.

  4. Step 4

    Toss fries until evenly coated, then sprinkle Parmesan and parsley over the top.

  5. Step 5

    Toss again gently and serve immediately while fries are still hot and crispy.

Tools you’ll need

  • sheet pan
  • oven
  • small skillet
  • large bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.