Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Garlic Shrimp Stir-Fry

Quick, garlicky shrimp with snap peas and bell pepper in a savory soy-ginger sauce. Ready in 20 minutes and perfect over rice.

Total time
20 min
Servings
2
Calories
245
Protein
28g
Garlic Shrimp Stir-Fry
quicksatisfyingchineseshrimpcrispytendercrunchyMain course

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk together soy sauce, ginger, and garlic in a small bowl. Set aside.

  2. Step 2

    Pat shrimp dry with paper towels. Season lightly with salt and pepper.

  3. Step 3

    Heat oil in a 12-inch skillet over medium-high until shimmering, about 60 seconds.

  4. Step 4

    Add shrimp in a single layer. Cook 90 seconds without stirring until one side turns opaque.

  5. Step 5

    Flip shrimp and cook another 90 seconds until just cooked through. Transfer to a plate.

  6. Step 6

    Add bell pepper and snap peas to the same skillet. Stir-fry for 3 minutes until tender-crisp.

  7. Step 7

    Pour the garlic-soy sauce into the skillet and stir constantly for 30 seconds until fragrant.

  8. Step 8

    Return shrimp to the skillet and toss to coat. Cook for 30 seconds to heat through.

  9. Step 9

    Taste and adjust salt and pepper. Serve hot over steamed rice.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • whisk
  • paper towels
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.